PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000360-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family Whirly
Protein Properties Length: 205aa    MW: 22526.3 Da    PI: 9.4059
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000360-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly85.66.2e-27101167167
           Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvd 67 
                      s+yk+kaal+v++++p+f  l+sg++kl+r+G ++l++a+a ++r+ydW++kq+f+ls+ e+++l  
  AHYPO_000360-RA 101 SIYKGKAALTVEPRAPDFLPLESGAFKLSREGCIMLQFAPASGVRQYDWSRKQVFSLSVSEIGSLFI 167
                      7***************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.7E-3292165IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.26E-3393193IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.2E-26102183IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAHQLLLSPP NFSIGTQLQT HGLNSNHFPS FSSHNSIITS ISHLKQTNNW VSNVSLSKPL  60
LSGVKCRQSS DYFEQSPSKL SSSYSPNSSP GVSPRVFVGH SIYKGKAALT VEPRAPDFLP  120
LESGAFKLSR EGCIMLQFAP ASGVRQYDWS RKQVFSLSVS EIGSLFILPY LIGWHAFVDS  180
IKPDDSNTTI SSNSRNLDSE WSRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_D6e-40601684110p24: plant transcriptional regulator PBF-2
1l3a_C6e-40601684110p24: plant transcriptional regulator PBF-2
1l3a_B6e-40601684110p24: plant transcriptional regulator PBF-2
1l3a_A6e-40601684110p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683246.17e-74PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ66GR68e-43WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
TrEMBLA0A0J8C4I48e-74A0A0J8C4I4_BETVU; Uncharacterized protein
STRINGfgenesh2_kg.5__172__AT2G02740.13e-41(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.11e-38ssDNA-binding transcriptional regulator